PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03605.1.g00050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 260aa    MW: 27830 Da    PI: 10.2072
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03605.1.g00050.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.23.1e-32182240159
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  Zpz_sc03605.1.g00050.1.am.mk 182 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 240
                                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-33167240IPR003657WRKY domain
SuperFamilySSF1182901.83E-28174241IPR003657WRKY domain
PROSITE profilePS5081129.356177242IPR003657WRKY domain
SMARTSM007749.8E-37182241IPR003657WRKY domain
PfamPF031064.3E-25183239IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MFPSPGRAAM ALGLGAQQLS STAAAGTSST PTVTFAFQPA PPTSDHSHHH HHHGVLGYGS  60
SHVLDCPTTA TSSSSSHAAA PSSTVPSSNL HHLQAAAAAA HVSLPTRSSP PHPWSSDERN  120
QDKQRGKGAT LTPGGGGLQH GAAAAALGVG AVRMKKAGGG KARRKMREPR FCFKTMSDVD  180
VLDDGYKWRK YGQKVVKNTQ HPRSYYRCTQ DNCRVKKRVE RLAEDPRMVI TTYEGRHVHS  240
PSHDDDDAAA RANAEMTFLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-26173239874Probable WRKY transcription factor 4
1wj2_A5e-26173239874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1087551e-123AK108755.1 Oryza sativa Japonica Group cDNA clone:002-150-F11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132878.11e-101putative WRKY DNA-binding domain superfamily protein
TrEMBLB4FIG21e-101B4FIG2_MAIZE; Uncharacterized protein
STRINGGRMZM2G151444_P011e-101(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.16e-47WRKY DNA-binding protein 13